SCOPe 2.06: Domain d1axga2: 1axg A:164-339

Lineage for d1axga2 (1axg A:164-339)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
N-terminal all-beta domain defines family
Protein Alcohol dehydrogenase [51737] (9 species)
Species Horse (Equus caballus) [TaxId:9796] [51738] (46 PDB entries)
Uniprot P00327
Domain d1axga2: 1axg A:164-339 [29707]
Other proteins in same PDB: d1axga1, d1axgb1, d1axgc1, d1axgd1
complexed with etf, nad, zn; mutant

Details for d1axga2

PDB Entry: 1axg (more details), 2.5 Å

PDB Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution

PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1axga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axga2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggaglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d1axga2:

Click to download the PDB-style file with coordinates for d1axga2.
(The format of our PDB-style files is described here.)

Timeline for d1axga2: