SCOPe 2.03: Domain d1axga1: 1axg A:1-163,A:340-374

Lineage for d1axga1 (1axg A:1-163,A:340-374)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meander
Superfamily b.35.1: GroES-like [50129] (3 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein Alcohol dehydrogenase [50137] (9 species)
contains a Zn-finger subdomain, residues 94-117
Species Horse (Equus caballus) [TaxId:9796] [50138] (40 PDB entries)
Uniprot P00327
Domain d1axga1: 1axg A:1-163,A:340-374 [24691]
Other proteins in same PDB: d1axga2, d1axgb2, d1axgc2, d1axgd2
complexed with etf, nad, zn; mutant

Details for d1axga1

PDB Entry: 1axg (more details), 2.5 Å

PDB Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution

PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1axga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axga1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d1axga1:

Click to download the PDB-style file with coordinates for d1axga1.
(The format of our PDB-style files is described here.)

Timeline for d1axga1: