Lineage for d1axca2 (1axc A:127-255)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431831Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1431832Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1432017Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1432039Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)
  7. 1432069Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries)
    Uniprot P12004
  8. 1432081Domain d1axca2: 1axc A:127-255 [41393]
    protein/DNA complex

Details for d1axca2

PDB Entry: 1axc (more details), 2.6 Å

PDB Description: human pcna
PDB Compounds: (A:) pcna

SCOPe Domain Sequences for d1axca2:

Sequence, based on SEQRES records: (download)

>d1axca2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records): (download)

>d1axca2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
eeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyy
lapki

SCOPe Domain Coordinates for d1axca2:

Click to download the PDB-style file with coordinates for d1axca2.
(The format of our PDB-style files is described here.)

Timeline for d1axca2:

1432081
d1axca2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1axca1