Lineage for d1awpa_ (1awp A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) 
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) 
Protein Cytochrome b5 [55858] (4 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries) 
Domain d1awpa_: 1awp A: [41071]
complexed with hem
Details for d1awpa_
PDB Entry: 1awp (more details), 2 Å
PDB Description: rat outer mitochondrial membrane cytochrome b5
PDB Compounds: (A:) cytochrome b5SCOPe Domain Sequences for d1awpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awpa_ d.120.1.1 (A:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeellleqagadatesfed
lghspdaremlkqyyigdvhpndlkp
SCOPe Domain Coordinates for d1awpa_:
Click to download the PDB-style file with coordinates for d1awpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1awpa_:
- d1awpa_ first appeared (with stable ids) in SCOP 1.55
- d1awpa_ appears in SCOPe 2.07
View in 3D
