Lineage for d1avpa_ (1avp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534426Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 2534427Protein Human adenovirus 2 proteinase, adenain [54055] (1 species)
  7. 2534428Species Mastadenovirus H2 [TaxId:10515] [54056] (3 PDB entries)
  8. 2534431Domain d1avpa_: 1avp A: [37132]
    complexed with peptide cofactor, chain B

Details for d1avpa_

PDB Entry: 1avp (more details), 2.6 Å

PDB Description: structure of human adenovirus 2 proteinase with its 11 amino acid cofactor
PDB Compounds: (A:) adenoviral proteinase

SCOPe Domain Sequences for d1avpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avpa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]}
mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
hspyfrshsaqirsatsfchlknm

SCOPe Domain Coordinates for d1avpa_:

Click to download the PDB-style file with coordinates for d1avpa_.
(The format of our PDB-style files is described here.)

Timeline for d1avpa_: