Lineage for d1avdb_ (1avd B:)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (1 family) 
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) 
Protein Avidin [50880] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries) 
Domain d1avdb_: 1avd B: [27414]
complexed with btn, nag
Details for d1avdb_
PDB Entry: 1avd (more details), 2.7 Å
PDB Description: three-dimensional structure of the tetragonal crystal form of egg- white avidin in its functional complex with biotin at 2.7 angstroms resolution
PDB Compounds: (B:) AvidinSCOP Domain Sequences for d1avdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avdb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt
SCOP Domain Coordinates for d1avdb_:
Click to download the PDB-style file with coordinates for d1avdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1avdb_:
- d1avdb_ first appeared (with stable ids) in SCOP 1.55
- d1avdb_ appears in SCOP 1.73
- d1avdb_ appears in SCOPe 2.01
- d1avdb_ appears in the current release, SCOPe 2.08
View in 3D
