Lineage for d1avac_ (1ava C:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (3 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
automatically mapped to Pfam PF00197
Protein Amylase/subtilisin inhibitor [50396] (1 species) Species Barley (Hordeum vulgare), seed [TaxId:4513] [50397] (2 PDB entries) 
Domain d1avac_: 1ava C: [25604]
Other proteins in same PDB: d1avaa1, d1avaa2, d1avab1, d1avab2
complexed with ca
Details for d1avac_
PDB Entry: 1ava (more details), 1.9 Å
PDB Description: amy2/basi protein-protein complex from barley seed
PDB Compounds: (C:) barley alpha-amylase/subtilisin inhibitorSCOPe Domain Sequences for d1avac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avac_ b.42.4.1 (C:) Amylase/subtilisin inhibitor {Barley (Hordeum vulgare), seed [TaxId: 4513]}
adpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfpv
ritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsps
grenafriekysgaevheyklmscgdwcqdlgvfrdlkggawflgatepyhvvvfkkapp
a
SCOPe Domain Coordinates for d1avac_:
Click to download the PDB-style file with coordinates for d1avac_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1avac_:
- d1avac_ first appeared (with stable ids) in SCOP 1.55
- d1avac_ appears in SCOPe 2.07
View in 3D
