Lineage for d1avac_ (1ava C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792431Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2792432Protein Amylase/subtilisin inhibitor [50396] (1 species)
  7. 2792433Species Barley (Hordeum vulgare), seed [TaxId:4513] [50397] (2 PDB entries)
  8. 2792436Domain d1avac_: 1ava C: [25604]
    Other proteins in same PDB: d1avaa1, d1avaa2, d1avab1, d1avab2
    complexed with ca

Details for d1avac_

PDB Entry: 1ava (more details), 1.9 Å

PDB Description: amy2/basi protein-protein complex from barley seed
PDB Compounds: (C:) barley alpha-amylase/subtilisin inhibitor

SCOPe Domain Sequences for d1avac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avac_ b.42.4.1 (C:) Amylase/subtilisin inhibitor {Barley (Hordeum vulgare), seed [TaxId: 4513]}
adpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfpv
ritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsps
grenafriekysgaevheyklmscgdwcqdlgvfrdlkggawflgatepyhvvvfkkapp
a

SCOPe Domain Coordinates for d1avac_:

Click to download the PDB-style file with coordinates for d1avac_.
(The format of our PDB-style files is described here.)

Timeline for d1avac_: