Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries) Uniprot P46881 9-628 |
Domain d1av4a2: 1av4 A:9-96 [38049] Other proteins in same PDB: d1av4a1 complexed with cu |
PDB Entry: 1av4 (more details), 2.2 Å
SCOPe Domain Sequences for d1av4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1av4a2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]} aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs garpqevtvsvtngtvisaveldtaatg
Timeline for d1av4a2: