Lineage for d1auoa_ (1auo A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151618Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 2151623Protein Carboxylesterase [53548] (2 species)
  7. 2151628Species Pseudomonas fluorescens [TaxId:294] [53549] (2 PDB entries)
  8. 2151629Domain d1auoa_: 1auo A: [34716]

Details for d1auoa_

PDB Entry: 1auo (more details), 1.8 Å

PDB Description: carboxylesterase from pseudomonas fluorescens
PDB Compounds: (A:) carboxylesterase

SCOPe Domain Sequences for d1auoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}
mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg

SCOPe Domain Coordinates for d1auoa_:

Click to download the PDB-style file with coordinates for d1auoa_.
(The format of our PDB-style files is described here.)

Timeline for d1auoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1auob_