Lineage for d1auda_ (1aud A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1415603Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1415903Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 1415908Species Human (Homo sapiens) [TaxId:9606] [54933] (43 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 1415970Domain d1auda_: 1aud A: [39156]
    protein/RNA complex

Details for d1auda_

PDB Entry: 1aud (more details)

PDB Description: u1a-utrrna, nmr, 31 structures
PDB Compounds: (A:) u1a 102

SCOPe Domain Sequences for d1auda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auda_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv

SCOPe Domain Coordinates for d1auda_:

Click to download the PDB-style file with coordinates for d1auda_.
(The format of our PDB-style files is described here.)

Timeline for d1auda_: