Lineage for d1auaa2 (1aua A:97-299)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460484Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2460485Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2460486Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
    Pfam PF00650
  6. 2460493Protein C-terminal domain of phosphatidylinositol transfer protein sec14p [52089] (1 species)
  7. 2460494Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52090] (1 PDB entry)
  8. 2460495Domain d1auaa2: 1aua A:97-299 [30882]
    Other proteins in same PDB: d1auaa1
    complexed with bog

Details for d1auaa2

PDB Entry: 1aua (more details), 2.5 Å

PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae
PDB Compounds: (A:) phosphatidylinositol transfer protein sec14p

SCOPe Domain Sequences for d1auaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auaa2 c.13.1.1 (A:97-299) C-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydekpliakfypqyyhktdkdgrpvyfeelgavnlhemnkvtseermlknlvweyesvvq
yrlpacsraaghlvetsctimdlkgisissaysvmsyvreasyisqnyypermgkfyiin
apfgfstafrlfkpfldpvtvskifilgssyqkellkqipaenlpvkfggksevdeskgg
lylsdigpwrdpkyigpegeape

SCOPe Domain Coordinates for d1auaa2:

Click to download the PDB-style file with coordinates for d1auaa2.
(The format of our PDB-style files is described here.)

Timeline for d1auaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1auaa1