Lineage for d1auaa2 (1aua A:97-299)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
core: 4 turns of a (beta-alpha)n superhelix
Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) 
automatically mapped to Pfam PF00650Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
Pfam PF00650
Protein C-terminal domain of phosphatidylinositol transfer protein sec14p [52089] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52090] (1 PDB entry) 
Domain d1auaa2: 1aua A:97-299 [30882]
Other proteins in same PDB: d1auaa1
complexed with bog
Details for d1auaa2
PDB Entry: 1aua (more details), 2.5 Å
PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae
PDB Compounds: (A:) phosphatidylinositol transfer protein sec14pSCOPe Domain Sequences for d1auaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auaa2 c.13.1.1 (A:97-299) C-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydekpliakfypqyyhktdkdgrpvyfeelgavnlhemnkvtseermlknlvweyesvvq
yrlpacsraaghlvetsctimdlkgisissaysvmsyvreasyisqnyypermgkfyiin
apfgfstafrlfkpfldpvtvskifilgssyqkellkqipaenlpvkfggksevdeskgg
lylsdigpwrdpkyigpegeape
SCOPe Domain Coordinates for d1auaa2:
Click to download the PDB-style file with coordinates for d1auaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1auaa2:
- d1auaa2 first appeared (with stable ids) in SCOP 1.55, called d1aua_2
- d1auaa2 appears in SCOPe 2.06
- d1auaa2 appears in the current release, SCOPe 2.08
View in 3D
