Lineage for d1auaa1 (1aua A:4-96)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
3 helices; bundle, right-handed twist
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) 
Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins) 
Protein N-terminal domain of phosphatidylinositol transfer protein sec14p [46940] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46941] (1 PDB entry) 
Domain d1auaa1: 1aua A:4-96 [16290]
Other proteins in same PDB: d1auaa2
complexed with bog
Details for d1auaa1
PDB Entry: 1aua (more details), 2.5 Å
PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae
PDB Compounds: (A:) phosphatidylinositol transfer protein sec14pSCOPe Domain Sequences for d1auaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auaa1 a.5.3.1 (A:4-96) N-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
arkfdvqlakemfencekwrkdygtdtilqdfh
SCOPe Domain Coordinates for d1auaa1:
Click to download the PDB-style file with coordinates for d1auaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1auaa1:
- d1auaa1 first appeared (with stable ids) in SCOP 1.55, called d1aua_1
- d1auaa1 appears in SCOPe 2.06
- d1auaa1 appears in the current release, SCOPe 2.08
View in 3D
