Lineage for d1au8a_ (1au8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404631Protein Cathepsin G [50548] (1 species)
  7. 2404632Species Human (Homo sapiens) [TaxId:9606] [50549] (4 PDB entries)
  8. 2404634Domain d1au8a_: 1au8 A: [26291]
    complexed with 0h8

Details for d1au8a_

PDB Entry: 1au8 (more details), 1.9 Å

PDB Description: human cathepsin g
PDB Compounds: (A:) cathepsin G

SCOPe Domain Sequences for d1au8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1au8a_ b.47.1.2 (A:) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs

SCOPe Domain Coordinates for d1au8a_:

Click to download the PDB-style file with coordinates for d1au8a_.
(The format of our PDB-style files is described here.)

Timeline for d1au8a_: