Lineage for d1asua_ (1asu A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606866Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1606867Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 1606946Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)
  8. 1606953Domain d1asua_: 1asu A: [33626]
    complexed with epe

Details for d1asua_

PDB Entry: 1asu (more details), 1.7 Å

PDB Description: avian sarcoma virus integrase catalytic core domain crystallized from 2% peg 400, 2m ammonium sulfate, hepes ph 7.5
PDB Compounds: (A:) avian sarcoma virus integrase

SCOPe Domain Sequences for d1asua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asua_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
plreprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwat
aiavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdki
rvlaegdgfmkriptskqgellakamyalnhfergentktnl

SCOPe Domain Coordinates for d1asua_:

Click to download the PDB-style file with coordinates for d1asua_.
(The format of our PDB-style files is described here.)

Timeline for d1asua_: