Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein SH3 domain from nebulin [50050] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50051] (2 PDB entries) |
Domain d1arka_: 1ark A: [24473] |
PDB Entry: 1ark (more details)
SCOPe Domain Sequences for d1arka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai
Timeline for d1arka_: