Lineage for d1arka_ (1ark A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946225Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 946514Protein SH3 domain from nebulin [50050] (1 species)
  7. 946515Species Human (Homo sapiens) [TaxId:9606] [50051] (2 PDB entries)
  8. 946517Domain d1arka_: 1ark A: [24473]

Details for d1arka_

PDB Entry: 1ark (more details)

PDB Description: sh3 domain from human nebulin, nmr, 15 structures
PDB Compounds: (A:) nebulin

SCOPe Domain Sequences for d1arka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]}
tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai

SCOPe Domain Coordinates for d1arka_:

Click to download the PDB-style file with coordinates for d1arka_.
(The format of our PDB-style files is described here.)

Timeline for d1arka_: