Lineage for d1arba_ (1arb A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545312Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1545313Protein Achromobacter protease [50496] (1 species)
  7. 1545314Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (3 PDB entries)
  8. 1545315Domain d1arba_: 1arb A: [25766]

Details for d1arba_

PDB Entry: 1arb (more details), 1.2 Å

PDB Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
PDB Compounds: (A:) achromobacter protease I

SCOPe Domain Sequences for d1arba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds

SCOPe Domain Coordinates for d1arba_:

Click to download the PDB-style file with coordinates for d1arba_.
(The format of our PDB-style files is described here.)

Timeline for d1arba_: