Lineage for d1ar1b2 (1ar1 B:1-107)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629436Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2629437Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 2629438Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries)
  8. 2629440Domain d1ar1b2: 1ar1 B:1-107 [43619]
    Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1c_, d1ar1d_
    complexed with ca, cu, hea, lda, mg

Details for d1ar1b2

PDB Entry: 1ar1 (more details), 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1ar1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar1b2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

SCOPe Domain Coordinates for d1ar1b2:

Click to download the PDB-style file with coordinates for d1ar1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ar1b2:

2629440
d1ar1b2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ar1b1