Lineage for d1aqia2 (1aqi A:244-413)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpinSuperfamily d.287.1: DNA methylase specificity domain [116734] (2 families) 
Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein) Protein DNA methylase TaqI, C-terminal domain [116736] (1 species) Species Thermus aquaticus [TaxId:271] [116737] (6 PDB entries) 
Domain d1aqia2: 1aqi A:244-413 [111560]
Other proteins in same PDB: d1aqia1, d1aqib1
Details for d1aqia2
PDB Entry: 1aqi (more details), 2.6 Å
PDB Description: structure of adenine-n6-dna-methyltransferase taqi
PDB Compounds: (A:) adenine-n6-DNA-methyltransferase taqiSCOP Domain Sequences for d1aqia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqia2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht
SCOP Domain Coordinates for d1aqia2:
Click to download the PDB-style file with coordinates for d1aqia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aqia2:
- d1aqia2 first appeared in SCOP 1.71
- d1aqia2 appears in SCOP 1.75
- d1aqia2 appears in the current release, SCOPe 2.08
View in 3D
