Lineage for d1aqda2 (1aqd A:3-81)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406537Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1406547Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 1406557Domain d1aqda2: 1aqd A:3-81 [38159]
    Other proteins in same PDB: d1aqda1, d1aqdb1, d1aqdb2, d1aqdd1, d1aqde1, d1aqde2, d1aqdg1, d1aqdh1, d1aqdh2, d1aqdj1, d1aqdk1, d1aqdk2

Details for d1aqda2

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide
PDB Compounds: (A:) hla-dr1 class II histocompatibility protein

SCOPe Domain Sequences for d1aqda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqda2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1aqda2:

Click to download the PDB-style file with coordinates for d1aqda2.
(The format of our PDB-style files is described here.)

Timeline for d1aqda2: