Lineage for d1ap4a_ (1ap4 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. Protein Troponin C [47503] (6 species)
  7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)
  8. Domain d1ap4a_: 1ap4 A: [17253]
    N-domain only
    complexed with ca

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1ap4a_

PDB Entry: 1ap4 (more details)

PDB Description: regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures
PDB Compounds: (A:) cardiac n-troponin c

SCOPe Domain Sequences for d1ap4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap4a_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

SCOPe Domain Coordinates for d1ap4a_ are not available.

Timeline for d1ap4a_: