Class b: All beta proteins [48724] (178 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.1: GroES [50130] (2 proteins) automatically mapped to Pfam PF00166 |
Protein Chaperonin-10 (GroES) [50131] (4 species) |
Species Escherichia coli [TaxId:562] [50132] (7 PDB entries) |
Domain d1aono_: 1aon O: [24642] Other proteins in same PDB: d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3 complexed with adp, mg |
PDB Entry: 1aon (more details), 3 Å
SCOPe Domain Sequences for d1aono_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} mnirplhdrvivkrkevetksaggivltgsaaakstrgevlavgngrilengevkpldvk vgdivifndgygvksekidneevlimsesdilaivea
Timeline for d1aono_:
View in 3D Domains from other chains: (mouse over for more information) d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |