Lineage for d1aohb_ (1aoh B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like foldSuperfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) 
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
Pfam PF00963
Protein Cohesin domain [49396] (2 species) 
Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries) 
Domain d1aohb_: 1aoh B: [22402]
cohesin domain from scaffolding protein CipA
Details for d1aohb_
PDB Entry: 1aoh (more details), 1.7 Å
PDB Description: single cohesin domain from the scaffolding protein cipa of the clostridium thermocellum cellulosome
PDB Compounds: (B:) cellulosome-integrating protein cipaSCOPe Domain Sequences for d1aohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aohb_ b.2.2.2 (B:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli
vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik
fvevggfanndlveqktqffdggvnvg
SCOPe Domain Coordinates for d1aohb_:
Click to download the PDB-style file with coordinates for d1aohb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aohb_:
- d1aohb_ first appeared (with stable ids) in SCOP 1.55
- d1aohb_ appears in SCOPe 2.04
- d1aohb_ is called d1aohb1 in SCOPe 2.06
- d1aohb_ appears in the current release, SCOPe 2.08, called d1aohb1
View in 3D
