Lineage for d1an1e_ (1an1 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2066005Species Pig (Sus scrofa) [TaxId:9823] [50517] (34 PDB entries)
    Uniprot P00761 9-231 ! Uniprot P00761
  8. 2066030Domain d1an1e_: 1an1 E: [25970]
    Other proteins in same PDB: d1an1i_
    complexed with ca

Details for d1an1e_

PDB Entry: 1an1 (more details), 2.03 Å

PDB Description: leech-derived tryptase inhibitor/trypsin complex
PDB Compounds: (E:) Trypsin

SCOPe Domain Sequences for d1an1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an1e_ b.47.1.2 (E:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatldsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

SCOPe Domain Coordinates for d1an1e_:

Click to download the PDB-style file with coordinates for d1an1e_.
(The format of our PDB-style files is described here.)

Timeline for d1an1e_: