Lineage for d1an1e_ (1an1 E:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) Protein Trypsin(ogen) [50515] (9 species) 
Species Pig (Sus scrofa) [TaxId:9823] [50517] (24 PDB entries)
Uniprot P00761 9-231 ! Uniprot P00761
Domain d1an1e_: 1an1 E: [25970]
Other proteins in same PDB: d1an1i_
complexed with ca
Details for d1an1e_
PDB Entry: 1an1 (more details), 2.03 Å
PDB Description: leech-derived tryptase inhibitor/trypsin complex
PDB Compounds: (E:) TrypsinSCOPe Domain Sequences for d1an1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1an1e_ b.47.1.2 (E:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatldsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
SCOPe Domain Coordinates for d1an1e_:
Click to download the PDB-style file with coordinates for d1an1e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1an1e_:
- d1an1e_ first appeared (with stable ids) in SCOP 1.55
- d1an1e_ appears in SCOPe 2.01
- d1an1e_ appears in SCOPe 2.03
- d1an1e_ appears in the current release, SCOPe 2.08
View in 3D
