Lineage for d1amma1 (1amm A:1-85)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-key
duplication: has internal pseudo twofold symmetrySuperfamily b.11.1: gamma-Crystallin-like [49695] (7 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) Protein gamma-Crystallin [49697] (8 species)
duplication consists of two domains of this fold
Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries) 
Domain d1amma1: 1amm A:1-85 [23587]
Details for d1amma1
PDB Entry: 1amm (more details), 1.2 Å
PDB Description: 1.2 angstrom structure of gamma-b crystallin at 150k
PDB Compounds: (A:) gamma b-crystallinSCOPe Domain Sequences for d1amma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amma1 b.11.1.1 (A:1-85) gamma-Crystallin {Cow (Bos taurus), isoform II (B) [TaxId: 9913]}
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqht
SCOPe Domain Coordinates for d1amma1:
Click to download the PDB-style file with coordinates for d1amma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1amma1:
- d1amma1 first appeared (with stable ids) in SCOP 1.55, called d1amm_1
- d1amma1 appears in SCOPe 2.04
- d1amma1 appears in SCOPe 2.06
- d1amma1 appears in the current release, SCOPe 2.08
View in 3D
