Lineage for d1amfa_ (1amf A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185903Protein Molybdate-binding protein, ModA [53883] (3 species)
  7. 1185911Species Escherichia coli [TaxId:562] [53884] (2 PDB entries)
  8. 1185912Domain d1amfa_: 1amf A: [35833]
    complexed with moo

Details for d1amfa_

PDB Entry: 1amf (more details), 1.75 Å

PDB Description: crystal structure of moda, a molybdate transport protein, complexed with molybdate
PDB Compounds: (A:) molybdate transport protein moda

SCOPe Domain Sequences for d1amfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]}
gkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw
mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh
vpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgvkv
vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik

SCOPe Domain Coordinates for d1amfa_:

Click to download the PDB-style file with coordinates for d1amfa_.
(The format of our PDB-style files is described here.)

Timeline for d1amfa_: