Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein Molybdate-binding protein, ModA [53883] (3 species) |
Species Escherichia coli [TaxId:562] [53884] (2 PDB entries) |
Domain d1amfa_: 1amf A: [35833] complexed with moo |
PDB Entry: 1amf (more details), 1.75 Å
SCOPe Domain Sequences for d1amfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} gkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh vpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgvkv vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik
Timeline for d1amfa_: