Lineage for d1akoa_ (1ako A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988189Protein DNA-repair enzyme exonuclease III [56221] (1 species)
  7. 2988190Species Escherichia coli [TaxId:562] [56222] (1 PDB entry)
  8. 2988191Domain d1akoa_: 1ako A: [41779]

Details for d1akoa_

PDB Entry: 1ako (more details), 1.7 Å

PDB Description: exonuclease iii from escherichia coli
PDB Compounds: (A:) exonuclease III

SCOPe Domain Sequences for d1akoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]}
mkfvsfninglrarphqleaivekhqpdviglqetkvhddmfpleevaklgynvfyhgqk
ghygvalltketpiavrrgfpgddeeaqrriimaeipsllgnvtvingyfpqgesrdhpi
kfpakaqfyqnlqnyletelkrdnpvlimgdmnisptdldigigeenrkrwlrtgkcsfl
peerewmdrlmswglvdtfrhanpqtadrfswfdyrskgfddnrglridlllasqplaec
cvetgidyeirsmekpsdhapvwatfrr

SCOPe Domain Coordinates for d1akoa_:

Click to download the PDB-style file with coordinates for d1akoa_.
(The format of our PDB-style files is described here.)

Timeline for d1akoa_: