![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
![]() | Domain d1akja1: 1akj A:182-276 [20688] Other proteins in same PDB: d1akja2, d1akjb_, d1akjd_, d1akje_ |
PDB Entry: 1akj (more details), 2.65 Å
SCOP Domain Sequences for d1akja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akja1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwep
Timeline for d1akja1: