Lineage for d1akja1 (1akj A:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654655Domain d1akja1: 1akj A:182-276 [20688]
    Other proteins in same PDB: d1akja2, d1akjb_, d1akjd_, d1akje_

Details for d1akja1

PDB Entry: 1akj (more details), 2.65 Å

PDB Description: complex of the human mhc class i glycoprotein hla-a2 and the t cell coreceptor cd8
PDB Compounds: (A:) MHC class I histocompatibility antigen (hla-a*0201) (alpha chain)

SCOP Domain Sequences for d1akja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akja1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1akja1:

Click to download the PDB-style file with coordinates for d1akja1.
(The format of our PDB-style files is described here.)

Timeline for d1akja1:

654655
d1akja1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1akja2