Lineage for d1ak8a_ (1ak8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710665Species Cow (Bos taurus) [TaxId:9913] [47518] (16 PDB entries)
    Uniprot P62157
  8. 2710679Domain d1ak8a_: 1ak8 A: [17281]
    N-terminal domain
    complexed with ce

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1ak8a_

PDB Entry: 1ak8 (more details)

PDB Description: nmr solution structure of cerium-loaded calmodulin amino-terminal domain (ce2-tr1c), 23 structures
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1ak8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak8a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}
madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
ngtidfpefltmmark

SCOPe Domain Coordinates for d1ak8a_:

Click to download the PDB-style file with coordinates for d1ak8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ak8a_: