Lineage for d1ak2a2 (1ak2 A:147-176)
- Root: SCOPe 2.06
Class g: Small proteins [56992] (94 folds) 
Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) 
automatically mapped to Pfam PF05191Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species) 
Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [57780] (2 PDB entries)
contains a rudiment "zinc-finger" subdomain
Domain d1ak2a2: 1ak2 A:147-176 [45195]
Other proteins in same PDB: d1ak2a1
complexed with so4
Details for d1ak2a2
PDB Entry: 1ak2 (more details), 1.92 Å
PDB Description: adenylate kinase isoenzyme-2
PDB Compounds: (A:) adenylate kinase isoenzyme-2SCOPe Domain Sequences for d1ak2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ak2a2 g.41.2.1 (A:147-176) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}
pqsgrsyheefnppkepmkdditgeplirr
SCOPe Domain Coordinates for d1ak2a2:
Click to download the PDB-style file with coordinates for d1ak2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ak2a2:
- d1ak2a2 first appeared (with stable ids) in SCOP 1.55, called d1ak2_2
- d1ak2a2 appears in SCOPe 2.05
- d1ak2a2 appears in SCOPe 2.07
- d1ak2a2 appears in the current release, SCOPe 2.08
View in 3D
