Lineage for d1ak0a_ (1ak0 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098051Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 1098052Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 1098079Family a.124.1.2: P1 nuclease [48543] (1 protein)
  6. 1098080Protein P1 nuclease [48544] (1 species)
  7. 1098081Species Fungus (Penicillium citrinum) [TaxId:5077] [48545] (1 PDB entry)
  8. 1098082Domain d1ak0a_: 1ak0 A: [19345]
    complexed with ads, nag, zn

Details for d1ak0a_

PDB Entry: 1ak0 (more details), 1.8 Å

PDB Description: p1 nuclease in complex with a substrate analog
PDB Compounds: (A:) p1 nuclease

SCOPe Domain Sequences for d1ak0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak0a_ a.124.1.2 (A:) P1 nuclease {Fungus (Penicillium citrinum) [TaxId: 5077]}
wgalghatvayvaqhyvspeaaswaqgilgsssssylasiaswadeyrltsagkwsaslh
fidaednpptncnvdyerdcgssgcsisaianytqrvsdsslssenhaealrflvhfigd
mtqplhdeayavggnkinvtfdgyhdnlhsdwdtympqkligghalsdaeswaktlvqni
esgnytaqaigwikgdnisepittatrwasdanalvctvvmphgaaalqtgdlyptyyds
vidtielqiakggyrlanwineih

SCOPe Domain Coordinates for d1ak0a_:

Click to download the PDB-style file with coordinates for d1ak0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ak0a_: