Lineage for d1ajea_ (1aje A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1362911Protein CDC42 [52619] (2 species)
  7. 1362912Species Human (Homo sapiens) [TaxId:9606] [52620] (26 PDB entries)
  8. 1362950Domain d1ajea_: 1aje A: [32071]

Details for d1ajea_

PDB Entry: 1aje (more details)

PDB Description: cdc42 from human, nmr, 20 structures
PDB Compounds: (A:) cdc42hs

SCOPe Domain Sequences for d1ajea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajea_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
gskiisamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytl
glfdtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllv
gtqidlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeai
laaleppepkksrr

SCOPe Domain Coordinates for d1ajea_:

Click to download the PDB-style file with coordinates for d1ajea_.
(The format of our PDB-style files is described here.)

Timeline for d1ajea_: