Lineage for d1aj2a_ (1aj2 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575887Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 1575888Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 1575889Protein Dihydropteroate synthetase [51719] (4 species)
  7. 1575955Species Escherichia coli [TaxId:562] [51720] (3 PDB entries)
  8. 1575956Domain d1aj2a_: 1aj2 A: [29665]
    complexed with 2ph, so4

Details for d1aj2a_

PDB Entry: 1aj2 (more details), 2 Å

PDB Description: crystal structure of a binary complex of e. coli dihydropteroate synthase
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d1aj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]}
mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
acaviaamqgahiirvhdvketveamrvveatlsakenkrye

SCOPe Domain Coordinates for d1aj2a_:

Click to download the PDB-style file with coordinates for d1aj2a_.
(The format of our PDB-style files is described here.)

Timeline for d1aj2a_: