![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
![]() | Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (4 species) |
![]() | Species Influenza A virus, different strains [TaxId:11320] [47063] (2 PDB entries) |
![]() | Domain d1aila_: 1ail A: [16381] |
PDB Entry: 1ail (more details), 1.9 Å
SCOPe Domain Sequences for d1aila_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aila_ a.16.1.1 (A:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza A virus, different strains [TaxId: 11320]} mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv gkqivekilk
Timeline for d1aila_: