Lineage for d1aigl_ (1aig L:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887887Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 887888Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 887889Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
    L and M are probably related to each other
  6. 887890Protein L (light) subunit [81477] (3 species)
  7. 887891Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries)
    Uniprot P02954
  8. 887938Domain d1aigl_: 1aig L: [43482]
    Other proteins in same PDB: d1aigh1, d1aigh2, d1aigm_, d1aigo_, d1aigp1, d1aigp2

Details for d1aigl_

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state
PDB Compounds: (L:) photosynthetic reaction center (l subunit)

SCOP Domain Sequences for d1aigl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aigl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1aigl_:

Click to download the PDB-style file with coordinates for d1aigl_.
(The format of our PDB-style files is described here.)

Timeline for d1aigl_: