Lineage for d1agwb_ (1agw B:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Fibroblast growth factor receptor 1 [56158] (1 species)
PTK group; FGFR subfamily; membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [56159] (20 PDB entries) 
Domain d1agwb_: 1agw B: [41696]
complexed with su2
Details for d1agwb_
PDB Entry: 1agw (more details), 2.4 Å
PDB Description: crystal structure of the tyrosine kinase domain of fibroblast growth factor receptor 1 in complex with su4984 inhibitor
PDB Compounds: (B:) fgf receptor 1SCOPe Domain Sequences for d1agwb_:
Sequence, based on SEQRES records: (download)
>d1agwb_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda
tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia
dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp
ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival
t
Sequence, based on observed residues (ATOM records): (download)
>d1agwb_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd
lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdl
vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkgrlpvkwmap
ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
ymmmrdcwhavpsqrptfkqlvedldrivalt
SCOPe Domain Coordinates for d1agwb_:
Click to download the PDB-style file with coordinates for d1agwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1agwb_:
- d1agwb_ first appeared (with stable ids) in SCOP 1.55
- d1agwb_ appears in SCOPe 2.03
- d1agwb_ appears in SCOPe 2.05
- d1agwb_ appears in the current release, SCOPe 2.08
View in 3D
