Lineage for d1agma_ (1agm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722037Family a.102.1.1: Glucoamylase [48209] (2 proteins)
    automatically mapped to Pfam PF00723
  6. 2722038Protein Glucoamylase [48210] (2 species)
  7. 2722039Species Aspergillus awamori, variant x100 [TaxId:105351] [48211] (6 PDB entries)
  8. 2722043Domain d1agma_: 1agm A: [18824]
    complexed with man

Details for d1agma_

PDB Entry: 1agm (more details), 2.3 Å

PDB Description: refined structure for the complex of acarbose with glucoamylase from aspergillus awamori var. x100 to 2.4 angstroms resolution
PDB Compounds: (A:) glucoamylase-471

SCOPe Domain Sequences for d1agma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agma_ a.102.1.1 (A:) Glucoamylase {Aspergillus awamori, variant x100 [TaxId: 105351]}
atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvi
ktlvdlfrngdtdllstiehyissqaiiqgvsnpsgdlssgglgepkfnvdetaytgswg
rpqrdgpalratamigfgqwlldngytsaateivwplvrndlsyvaqywnqtgydlweev
ngssfftiavqhralvegsafatavgsscswcdsqapqilcylqsfwtgsyilanfdssr
sgkdtntllgsihtfdpeagcddstfqpcspralanhkevvdsfrsiytlndglsdseav
avgrypedsyyngnpwflctlaaaeqlydalyqwdkqgsleitdvsldffkalysgaatg
tyssssstyssivsavktfadgfvsivethaasngslseqfdksdgdelsardltwsyaa
lltannrrnsvvppswgetsassvpgtcaatsasgtyssvtvtswpsiva

SCOPe Domain Coordinates for d1agma_:

Click to download the PDB-style file with coordinates for d1agma_.
(The format of our PDB-style files is described here.)

Timeline for d1agma_: