Lineage for d1afpa_ (1afp A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891858Fold g.26: Antifungal protein (AGAFP) [57597] (1 superfamily)
    disulfide-rich; all-beta: open barrel, 5 strands; OB-fold-like
  4. 891859Superfamily g.26.1: Antifungal protein (AGAFP) [57598] (1 family) (S)
  5. 891860Family g.26.1.1: Antifungal protein (AGAFP) [57599] (1 protein)
  6. 891861Protein Antifungal protein (AGAFP) [57600] (1 species)
  7. 891862Species Mold (Aspergillus giganteus) [TaxId:5060] [57601] (1 PDB entry)
  8. 891863Domain d1afpa_: 1afp A: [44947]

Details for d1afpa_

PDB Entry: 1afp (more details)

PDB Description: solution structure of the antifungal protein from aspergillus giganteus. evidence for disulphide configurational isomerism
PDB Compounds: (A:) antifungal protein from aspergillus giganteus

SCOP Domain Sequences for d1afpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afpa_ g.26.1.1 (A:) Antifungal protein (AGAFP) {Mold (Aspergillus giganteus) [TaxId: 5060]}
atyngkcykkdnickykaqsgktaickcyvkkcprdgakcefdsykgkcyc

SCOP Domain Coordinates for d1afpa_:

Click to download the PDB-style file with coordinates for d1afpa_.
(The format of our PDB-style files is described here.)

Timeline for d1afpa_: