Lineage for d1ad3a_ (1ad3 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.82: ALDH-like [53719] (1 superfamily)
consists of two similar domains with 3 layers (a/b/a) each; duplication
core: parallel beta-sheet of 5 strands, order 32145Superfamily c.82.1: ALDH-like [53720] (3 families) 
binds NAD differently from other NAD(P)-dependent oxidoreductases
Family c.82.1.1: ALDH-like [53721] (6 proteins) 
Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [53723] (1 PDB entry) 
Domain d1ad3a_: 1ad3 A: [35335]
complexed with nad
Details for d1ad3a_
PDB Entry: 1ad3 (more details), 2.6 Å
PDB Description: class 3 aldehyde dehydrogenase complex with nicotinamide-adenine-dinucleotide
PDB Compounds: (A:) aldehyde dehydrogenase (class 3)SCOPe Domain Sequences for d1ad3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sisdtvkrareafnsgktrslqfriqqlealqrminenlksisgalasdlgknewtsyye
evahvleeldttikelpdwaedepvaktrqtqqddlyihseplgvvlvigawnypfnlti
qpmvgavaagnavilkpsevsghmadllatlipqymdqnlylvvkggvpettellkerfd
himytgstavgkivmaaaakhltpvtlelggkspcyvdkdcdldvacrriawgkfmnsgq
tcvapdyilcdpsiqnqiveklkkslkdfygedakqsrdygriindrhfqrvkglidnqk
vahggtwdqssryiaptilvdvdpqspvmqeeifgpvmpivcvrsleeaiqfinqrekpl
alyvfsnnekvikkmiaetssggvtandvivhitvptlpfggvgnsgmgayhgkksfetf
shrrsclvksllneeahkaryppspa
SCOPe Domain Coordinates for d1ad3a_:
Click to download the PDB-style file with coordinates for d1ad3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ad3a_:
- d1ad3a_ first appeared (with stable ids) in SCOP 1.55
- d1ad3a_ appears in SCOPe 2.07
View in 3D
