Lineage for d1abra_ (1abr A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. Protein Abrin A-chain [56383] (1 species)
  7. Species Abrus precatorius [TaxId:3816] [56384] (1 PDB entry)
  8. Domain d1abra_: 1abr A: [42196]
    Other proteins in same PDB: d1abrb1, d1abrb2

Details for d1abra_

PDB Entry: 1abr (more details), 2.14 Å

PDB Description: crystal structure of abrin-a
PDB Compounds: (A:) abrin-a

SCOPe Domain Sequences for d1abra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abra_ d.165.1.1 (A:) Abrin A-chain {Abrus precatorius [TaxId: 3816]}
edrpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlqernryitvelsnsd
tesievgidvtnayvvayragtqsyflrdapssasdylftgtdqhslpfygtygdlerwa
hqsrqqiplglqalthgisffrsggndneekartliviiqmvaeaarfryisnrvrvsiq
tgtafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnepvivdslshptvavl
almlfvcnppn

SCOPe Domain Coordinates for d1abra_ are not available.

Timeline for d1abra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1abrb1, d1abrb2