Lineage for d1aafa_ (1aaf A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705740Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 1705741Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 1705742Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 1705746Protein HIV nucleocapsid [57760] (2 species)
    duplication: two similar zinc-binding motifs
  7. 1705747Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (12 PDB entries)
    Uniprot P03350 389-429
  8. 1705753Domain d1aafa_: 1aaf A: [45166]
    complexed with zn

Details for d1aafa_

PDB Entry: 1aaf (more details)

PDB Description: nucleocapsid zinc fingers detected in retroviruses: exafs studies on intact viruses and the solution-state structure of the nucleocapsid protein from hiv-1
PDB Compounds: (A:) hiv-1 nucleocapsid protein

SCOPe Domain Sequences for d1aafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aafa_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]}
mqrgnfrnqrkiikcfncgkeghiakncraprkrgcwkcgkeghqmkdcterqan

SCOPe Domain Coordinates for d1aafa_:

Click to download the PDB-style file with coordinates for d1aafa_.
(The format of our PDB-style files is described here.)

Timeline for d1aafa_: