Lineage for d1aaba_ (1aab A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2697959Protein High mobility group protein 1, HMG1 [47097] (2 species)
    duplication: contains HMG-box domains
  7. 2697966Species Norway rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)
  8. 2697970Domain d1aaba_: 1aab A: [16420]
    domain A

Details for d1aaba_

PDB Entry: 1aab (more details)

PDB Description: nmr structure of rat hmg1 hmga fragment
PDB Compounds: (A:) high mobility group protein

SCOPe Domain Sequences for d1aaba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aaba_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gkgdpkkprgkmssyaffvqtsreehkkkhpdasvnfsefskkcserwktmsakekgkfe
dmakadkaryeremktyippkge

SCOPe Domain Coordinates for d1aaba_:

Click to download the PDB-style file with coordinates for d1aaba_.
(The format of our PDB-style files is described here.)

Timeline for d1aaba_: