Lineage for d1aa7b_ (1aa7 B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
multihelical; consists of two different all-alpha subdomains, 4 helices eachSuperfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) 
superficially similar to membrane translocation domains
automatically mapped to Pfam PF00598Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) 
Protein Influenza virus matrix protein M1 [48147] (1 species)
bifunctional membrane/RNA-binding proteinSpecies Influenza A virus, different strains [TaxId:11320] [48148] (2 PDB entries) 
Domain d1aa7b_: 1aa7 B: [18742]
Details for d1aa7b_
PDB Entry: 1aa7 (more details), 2.08 Å
PDB Description: influenza virus matrix protein crystal structure at ph 4.0
PDB Compounds: (B:) influenza virus matrix proteinSCOPe Domain Sequences for d1aa7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aa7b_ a.95.1.1 (B:) Influenza virus matrix protein M1 {Influenza A virus, different strains [TaxId: 11320]}
slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
galascmgliynrmgavttevafglvcatceqiadsq
SCOPe Domain Coordinates for d1aa7b_:
Click to download the PDB-style file with coordinates for d1aa7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aa7b_:
- d1aa7b_ first appeared (with stable ids) in SCOP 1.55
- d1aa7b_ appears in SCOPe 2.07
View in 3D
