| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily) multihelical; consists of two different all-alpha subdomains, 4 helices each |
Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) ![]() superficially similar to membrane translocation domains automatically mapped to Pfam PF00598 |
| Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) |
| Protein Influenza virus matrix protein M1 [48147] (1 species) bifunctional membrane/RNA-binding protein |
| Species Influenza A virus, different strains [TaxId:11320] [48148] (2 PDB entries) |
| Domain d1aa7b_: 1aa7 B: [18742] |
PDB Entry: 1aa7 (more details), 2.08 Å
SCOPe Domain Sequences for d1aa7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aa7b_ a.95.1.1 (B:) Influenza virus matrix protein M1 {Influenza A virus, different strains [TaxId: 11320]}
slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
galascmgliynrmgavttevafglvcatceqiadsq
Timeline for d1aa7b_: