Lineage for d1a9o__ (1a9o -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587177Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 587193Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 587194Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 587281Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)
  7. 587296Species Cow (Bos taurus) [TaxId:9913] [53171] (16 PDB entries)
  8. 587310Domain d1a9o__: 1a9o - [33770]
    complexed with po4

Details for d1a9o__

PDB Entry: 1a9o (more details), 2 Å

PDB Description: bovine purine nucleoside phosphorylase complexed with phosphate

SCOP Domain Sequences for d1a9o__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9o__ c.56.2.1 (-) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasipvsghtg

SCOP Domain Coordinates for d1a9o__:

Click to download the PDB-style file with coordinates for d1a9o__.
(The format of our PDB-style files is described here.)

Timeline for d1a9o__: