Lineage for d1a8ha2 (1a8h A:1-348)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
contains a conserved all-alpha subdomain at the C-terminal extension
Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species) - Species Thermus thermophilus [TaxId:274] [52385] (1 PDB entry)
Domain d1a8ha2: 1a8h A:1-348 [31589]
Other proteins in same PDB: d1a8ha1
complexed with zn
Details for d1a8ha2
PDB Entry: 1a8h (more details), 2 Å
PDB Description: methionyl-trna synthetase from thermus thermophilus
PDB Compounds: (A:) Methionyl-tRNA synthetaseSCOPe Domain Sequences for d1a8ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8ha2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead
SCOPe Domain Coordinates for d1a8ha2:
Click to download the PDB-style file with coordinates for d1a8ha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8ha2:
- d1a8ha2 first appeared (with stable ids) in SCOP 1.55, called d1a8h_2
- d1a8ha2 appears in SCOPe 2.06
- d1a8ha2 appears in the current release, SCOPe 2.08
View in 3D
