Lineage for d1a8ha2 (1a8h A:1-348)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841431Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)
  7. Species Thermus thermophilus [TaxId:274] [52385] (1 PDB entry)
  8. 1841445Domain d1a8ha2: 1a8h A:1-348 [31589]
    Other proteins in same PDB: d1a8ha1
    complexed with zn

Details for d1a8ha2

PDB Entry: 1a8h (more details), 2 Å

PDB Description: methionyl-trna synthetase from thermus thermophilus
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1a8ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8ha2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

SCOPe Domain Coordinates for d1a8ha2:

Click to download the PDB-style file with coordinates for d1a8ha2.
(The format of our PDB-style files is described here.)

Timeline for d1a8ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8ha1