Lineage for d1a8a__ (1a8a -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539977Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 539978Superfamily a.65.1: Annexin [47874] (1 family) (S)
    duplication: consists of four domains of the same fold
  5. 539979Family a.65.1.1: Annexin [47875] (9 proteins)
  6. 540005Protein Annexin V [47883] (3 species)
  7. 540024Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (13 PDB entries)
  8. 540026Domain d1a8a__: 1a8a - [18169]
    complexed with ca, gse

Details for d1a8a__

PDB Entry: 1a8a (more details), 1.9 Å

PDB Description: rat annexin v complexed with glycerophosphoserine

SCOP Domain Sequences for d1a8a__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8a__ a.65.1.1 (-) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

SCOP Domain Coordinates for d1a8a__:

Click to download the PDB-style file with coordinates for d1a8a__.
(The format of our PDB-style files is described here.)

Timeline for d1a8a__: