Lineage for d1a7xa_ (1a7x A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) 
Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
cis-trans prolyl-isomeraseSpecies Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries) 
Domain d1a7xa_: 1a7x A: [38405]
complexed with fka
Details for d1a7xa_
PDB Entry: 1a7x (more details), 2 Å
PDB Description: fkbp12-fk1012 complex
PDB Compounds: (A:) fkbp12SCOPe Domain Sequences for d1a7xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7xa_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
SCOPe Domain Coordinates for d1a7xa_:
Click to download the PDB-style file with coordinates for d1a7xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a7xa_:
- d1a7xa_ first appeared (with stable ids) in SCOP 1.55
- d1a7xa_ appears in SCOPe 2.03
- d1a7xa_ appears in SCOPe 2.05
- d1a7xa_ appears in the current release, SCOPe 2.08
View in 3D
