![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Laccase, C-terminal domain [418907] (5 species) |
![]() | Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [419312] (2 PDB entries) |
![]() | Domain d1a65a3: 1a65 A:304-504 [23150] Other proteins in same PDB: d1a65a1, d1a65a2 complexed with cu, nag, o, pye has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1a65 (more details), 2.23 Å
SCOPe Domain Sequences for d1a65a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a65a3 b.6.1.3 (A:304-504) Laccase, C-terminal domain {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew aqlceiyddlppeatsiqtvv
Timeline for d1a65a3: