Lineage for d1a65a3 (1a65 A:304-504)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771289Protein Laccase, C-terminal domain [418907] (5 species)
  7. 2771309Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [419312] (2 PDB entries)
  8. 2771311Domain d1a65a3: 1a65 A:304-504 [23150]
    Other proteins in same PDB: d1a65a1, d1a65a2
    complexed with cu, nag, o, pye
    has additional insertions and/or extensions that are not grouped together

Details for d1a65a3

PDB Entry: 1a65 (more details), 2.23 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d1a65a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a65a3 b.6.1.3 (A:304-504) Laccase, C-terminal domain {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}
neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq
sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk
rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew
aqlceiyddlppeatsiqtvv

SCOPe Domain Coordinates for d1a65a3:

Click to download the PDB-style file with coordinates for d1a65a3.
(The format of our PDB-style files is described here.)

Timeline for d1a65a3: