Lineage for d1a63_2 (1a63 48-130)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 560063Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 560064Species Escherichia coli [TaxId:562] [68911] (8 PDB entries)
  8. 560095Domain d1a63_2: 1a63 48-130 [64711]
    Other proteins in same PDB: d1a63_1

Details for d1a63_2

PDB Entry: 1a63 (more details)

PDB Description: the nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures

SCOP Domain Sequences for d1a63_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a63_2 b.40.4.5 (48-130) Rho termination factor, RNA-binding domain {Escherichia coli}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpenarnk

SCOP Domain Coordinates for d1a63_2:

Click to download the PDB-style file with coordinates for d1a63_2.
(The format of our PDB-style files is described here.)

Timeline for d1a63_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a63_1